PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_0174177391.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YC
Protein Properties Length: 85aa    MW: 9488.86 Da    PI: 4.5217
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_0174177391.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC127.93.7e-4017230101
                   NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                             +kadedv+misaeaPvl++kacelfilelt+rswlhaeenkrrtl+++d+aaa++rtd+fdflvdivpr+e 
  Traes_4BL_0174177391.1   1 MKADEDVRMISAEAPVLFAKACELFILELTIRSWLHAEENKRRTLQRNDVAAAIARTDVFDFLVDIVPREEA 72 
                             9********************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.36E-24169IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.4E-30169IPR009072Histone-fold
PfamPF008082.9E-14154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKADEDVRMI SAEAPVLFAK ACELFILELT IRSWLHAEEN KRRTLQRNDV AAAIARTDVF  60
DFLVDIVPRE EAKEEPGSAA LGFAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C2e-3416951119HapE
4g92_C2e-3416951119HapE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQRN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787291e-131KM078729.1 Triticum aestivum CCAAT-binding transcription factor C (NFYC-D5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558340.12e-54PREDICTED: nuclear transcription factor Y subunit C-1-like
SwissprotQ9FMV51e-46NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
TrEMBLM7YWQ82e-55M7YWQ8_TRIUA; Nuclear transcription factor Y subunit C-4
STRINGBRADI1G67980.16e-54(Brachypodium distachyon)
STRINGMLOC_69830.16e-54(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP73453551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63470.27e-48nuclear factor Y, subunit C4